PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_75867.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YB
Protein Properties Length: 163aa    MW: 17824 Da    PI: 8.6815
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_75867.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB122.32.1e-3826117697
         NF-YB   6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                     lP+anv+r+m++vlP+n ki++ ak+++++c++ef++fv +eas++++ e r+t++++d+ w+  +lGf+ yv+p+++yl+ yre ++++
  MLOC_75867.1  26 SALPMANVVRLMRRVLPSNVKIAESAKQLTHDCAVEFVGFVRGEASERARSEYRRTVAPEDFTWSCQSLGFDSYVQPMQTYLRGYREYDTAR 117
                   689************************************************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.6E-3022122IPR009072Histone-fold
SuperFamilySSF471136.48E-2427119IPR009072Histone-fold
PfamPF008086.4E-152888IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.6E-75573No hitNo description
PRINTSPR006154.6E-77492No hitNo description
PRINTSPR006154.6E-793111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MGGRSKKHGG QRGEGDEENP AAEGGSALPM ANVVRLMRRV LPSNVKIAES AKQLTHDCAV  60
EFVGFVRGEA SERARSEYRR TVAPEDFTWS CQSLGFDSYV QPMQTYLRGY REYDTARGRS  120
TRGARAPAPP AMTSFASPGE PVTVTKEELE FLRSVIPPPP GGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A6e-2523112493NF-YB
4csr_A6e-2523112594NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B6e-2523112594NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649006.11e-43PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ6Z3489e-43NFYB1_ORYSJ; Nuclear transcription factor Y subunit B-1
TrEMBLM0Z2J11e-117M0Z2J1_HORVD; Uncharacterized protein
STRINGMLOC_75867.11e-117(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136592631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.23e-23nuclear factor Y, subunit B6